pet 28 Search Results


90
Galectin Therapeutics pet-28 plasmid
Macromolecule-production information
Pet 28 Plasmid, supplied by Galectin Therapeutics, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pet-28 plasmid/product/Galectin Therapeutics
Average 90 stars, based on 1 article reviews
pet-28 plasmid - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
Novogen Inc pet-28
Macromolecule-production information
Pet 28, supplied by Novogen Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pet-28/product/Novogen Inc
Average 90 stars, based on 1 article reviews
pet-28 - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
GoldenGate Software Inc pet28_goldengate_site_fw
Macromolecule-production information
Pet28 Goldengate Site Fw, supplied by GoldenGate Software Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pet28_goldengate_site_fw/product/GoldenGate Software Inc
Average 90 stars, based on 1 article reviews
pet28_goldengate_site_fw - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
Merck & Co pet-28
Macromolecule-production information
Pet 28, supplied by Merck & Co, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pet-28/product/Merck & Co
Average 90 stars, based on 1 article reviews
pet-28 - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
Biomatik lyophilized pet-28 plasmids containing the genes of interest inserted via the ncoi/xhoi cloning sites
Macromolecule-production information
Lyophilized Pet 28 Plasmids Containing The Genes Of Interest Inserted Via The Ncoi/Xhoi Cloning Sites, supplied by Biomatik, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/lyophilized pet-28 plasmids containing the genes of interest inserted via the ncoi/xhoi cloning sites/product/Biomatik
Average 90 stars, based on 1 article reviews
lyophilized pet-28 plasmids containing the genes of interest inserted via the ncoi/xhoi cloning sites - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
Avidis Inc pet-28 containing 6his-v0c construct
Macromolecule-production information
Pet 28 Containing 6his V0c Construct, supplied by Avidis Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pet-28 containing 6his-v0c construct/product/Avidis Inc
Average 90 stars, based on 1 article reviews
pet-28 containing 6his-v0c construct - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
Merck & Co pet-28(+) vector
Macromolecule-production information
Pet 28(+) Vector, supplied by Merck & Co, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pet-28(+) vector/product/Merck & Co
Average 90 stars, based on 1 article reviews
pet-28(+) vector - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
Shanghai Generay Biotech pet-28 plasmid
Macromolecule-production information
Pet 28 Plasmid, supplied by Shanghai Generay Biotech, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pet-28 plasmid/product/Shanghai Generay Biotech
Average 90 stars, based on 1 article reviews
pet-28 plasmid - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
Genechem pet-28 vector
Macromolecule-production information
Pet 28 Vector, supplied by Genechem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pet-28 vector/product/Genechem
Average 90 stars, based on 1 article reviews
pet-28 vector - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
General Biosystems Inc pet28 vector a modified vector of pet-28
Macromolecule-production information
Pet28 Vector A Modified Vector Of Pet 28, supplied by General Biosystems Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pet28 vector a modified vector of pet-28/product/General Biosystems Inc
Average 90 stars, based on 1 article reviews
pet28 vector a modified vector of pet-28 - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
Hyosung Corporation pet 28,000
Macromolecule-production information
Pet 28,000, supplied by Hyosung Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pet 28,000/product/Hyosung Corporation
Average 90 stars, based on 1 article reviews
pet 28,000 - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

90
Cargill Inc polyester (pet, 0.28-mm thickness) films
Macromolecule-production information
Polyester (Pet, 0.28 Mm Thickness) Films, supplied by Cargill Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/polyester (pet, 0.28-mm thickness) films/product/Cargill Inc
Average 90 stars, based on 1 article reviews
polyester (pet, 0.28-mm thickness) films - by Bioz Stars, 2026-05
90/100 stars
  Buy from Supplier

Image Search Results


Macromolecule-production information

Journal: Acta Crystallographica. Section F, Structural Biology Communications

Article Title: Cloning, expression, purification and crystallographic studies of galectin-11 from domestic sheep ( Ovis aries )

doi: 10.1107/S2053230X15010195

Figure Lengend Snippet: Macromolecule-production information

Article Snippet: The clone obtained was confirmed by DNA sequencing. table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 Source organism O. aries DNA source O. aries cDNA Forward primer 5-CAGGGACCCGGTATGGACTCCTTGCCG-3 Reverse primer 5-CGAGGAGAAGCCCGGTTATAACGTATCCACT-3 Cloning vector pET-28 plasmid Expression vector pET-28 plasmid Expression host E. coli BL21 (DE3) Complete amino-acid sequence of the full-length construct produced (galectin-11 1140 ) MAHHHHHHSAALEVLFQGPGMDSLPNPYLQSVSLTVCYMVKIKANLLSPFGKNPELQVDFGTGTGQGGDIPFRFWYCDGIVVMNTLKDGSWGKEQKLHTEAFVPGQPFELQFLVLENEYQVFVNNKPICQFAHRLPLQSVKMLDVRGDIVLTSVDTL Amino-acid sequence of crystallized galectin-11 after HCV-3C protease treatment (galectin-11 18140 ) GPGMDSLPNPYLQSVSLTVCYMVKIKANLLSPFGKNPELQVDFGTGTGQGGDIPFRFWYCDGIVVMNTLKDGSWGKEQKLHTEAFVPGQPFELQFLVLENEYQVFVNNKPICQFAHRLPLQSVKMLDVRGDIVLTSVDTL Open in a separate window caption a8 Macromolecule-production information 2.1.2.

Techniques: Cloning, Plasmid Preparation, Expressing, Sequencing, Construct, Produced